SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224033|ref|YP_007108130.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224033|ref|YP_007108130.1|
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 1.7e-46
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428224033|ref|YP_007108130.1|
Sequence length 296
Comment ABC-3 protein [Geitlerinema sp. PCC 7407]
Sequence
MEALLEPLQYGFMQRSLIIAVLVGIVCALVGSYLMVQRLALLGDAISHSVLPGLAIAFLL
DLNLFIGAFIAGMLSTVAIAWIRTRSPIKEDAAMGIVFSAFFALGITLITVVQKDNKIDL
NHFLFGNILGVTGGDVRDTAIIAAIVVITVGLLYKELLFYTFDPLGAQAVGLPVNLLNFG
LMALIALTVVASLKAVGVVLVLSLLITPGATAYLLVPRLHQVMLLGAVIGVISSISGMYL
SYWYNLPSGPAIVLVVSGFFVLALLFSPLYGVLTQPGRGSLEIPLWREIRTLWRSR
Download sequence
Identical sequences K9S4E6
WP_015170646.1.54702 gi|428224033|ref|YP_007108130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]