SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224118|ref|YP_007108215.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224118|ref|YP_007108215.1|
Domain Number 1 Region: 14-44
Classification Level Classification E-value
Superfamily Subunit XII of photosystem I reaction centre, PsaM 0.00000000785
Family Subunit XII of photosystem I reaction centre, PsaM 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428224118|ref|YP_007108215.1|
Sequence length 44
Comment photosystem I reaction center subunit XII [Geitlerinema sp. PCC 7407]
Sequence
MGNHVERLGSIPTMALSDMQIYAALAIALVPGILAIRLATELYK
Download sequence
Identical sequences K9S4N2
WP_015170731.1.54702 gi|428224118|ref|YP_007108215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]