SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224132|ref|YP_007108229.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224132|ref|YP_007108229.1|
Domain Number 1 Region: 215-330
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 3.53e-34
Family DRTGG domain 0.00018
Further Details:      
 
Domain Number 2 Region: 7-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-27
Family Nitrogenase iron protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428224132|ref|YP_007108229.1|
Sequence length 365
Comment DRTGG domain-containing protein [Geitlerinema sp. PCC 7407]
Sequence
MPESNQYLLVGSTEAYSGKSAMILGIANQLRTCGLEIAYGKPIGTCFAEAADSKGALVDE
DVLFVAETLELSPDRLRPTLLPLDTAALERRIGGEDTTLYSEKLAQSFQAQGEDLVLLEG
PGTLDEGRLFELSLPQMAETMNAPVLLVARFILASTVDTLMAARERLGDRLLGVLLNDVP
RDQLEFVQSSVCPFLEARGIPVFGTFPRSSLLRSVSVAELVKKLDAEVLCRGDRLDLMVE
SLTIGAMNVNSALKYFRKGRNMAVVTGGDRTDIQLAALETSTQCLILTGHLPPVPMILSR
AEDLEIPILSVDLDTLTTVEIIDQAFGQVRLQEPAKVEHVFRMMGEHLDCDRLLQNLGLR
TKVAL
Download sequence
Identical sequences K9S3G8
WP_015170745.1.54702 gi|428224132|ref|YP_007108229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]