SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224155|ref|YP_007108252.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224155|ref|YP_007108252.1|
Domain Number 1 Region: 97-465
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.06e-93
Family Amylase, catalytic domain 0.0000152
Further Details:      
 
Domain Number 2 Region: 7-74
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000892
Family AMPK-beta glycogen binding domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 470-548
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000334
Family alpha-Amylases, C-terminal beta-sheet domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428224155|ref|YP_007108252.1|
Sequence length 549
Comment alpha amylase [Geitlerinema sp. PCC 7407]
Sequence
MANNIEFQLFAPYNQGAALIGSFSDWEEIPMKKGDDGYFRTQVALEDGEYHYKFRVQSRS
WFLEPDAWVDIVDPYATDVDSPTQNGVVRIKDGQIIVDTYVWQNDDKPLPPDHELVIYEM
HISDFSGGEDDPLERGKFRHVIEKLDYLCDLGVNAIEIMPVKEYPGDYSWGYNPRYFCAV
ESSYGGSDGLKRLIDECHGRGIRVILDGVYNHSEASCPLTQIDHDYWYHHEPRDPDNNWG
PEFNYEHYDDNLDTYPARKFIGDVVRFWIEEYHIDGIRYDAARQMANYDFMHWIVQETKQ
AAGSKPFYNIAEHIPETTSITGLEGPMDGCWHESFYHCVLAHICGDTFDLEPLKDAIDGK
RQGFLGATNLVNYLTNHDHNHVLAELADRDIFDEAAFKRVKLGAALLMTAMGVPLIWMGE
EFGEYKYKSIEPSKIEWPLLANDLNQGLLNYYKGLLHLRKTNQALYGENVEFFHENPESR
VLAYTRWNDEGSRVVVVANFSDQFLAGYAVPNFPADGTWHEWTGDYDVEVGDRTLMTDLP
EYEAKVFVW
Download sequence
Identical sequences K9S4V0
gi|428224155|ref|YP_007108252.1| WP_015170768.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]