SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224263|ref|YP_007108360.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224263|ref|YP_007108360.1|
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily L28p-like 8.63e-26
Family Ribosomal protein L31p 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428224263|ref|YP_007108360.1|
Sequence length 80
Comment 50S ribosomal protein L31 [Geitlerinema sp. PCC 7407]
Sequence
MAKPNIHPEWHPEAKVYCNGELVMTVGSTQPEIHVDVWSGNHPFYTGTQKIIDTEGRVER
FLRKYGMMDGSQAGSAASEN
Download sequence
Identical sequences K9S539
WP_015170875.1.54702 gi|428224263|ref|YP_007108360.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]