SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224289|ref|YP_007108386.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224289|ref|YP_007108386.1|
Domain Number 1 Region: 116-299,434-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.38e-106
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000579
Further Details:      
 
Domain Number 2 Region: 296-429
Classification Level Classification E-value
Superfamily GAD domain-like 1.08e-33
Family GAD domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.05e-33
Family Anticodon-binding domain 0.000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428224289|ref|YP_007108386.1|
Sequence length 601
Comment aspartyl-tRNA synthetase [Geitlerinema sp. PCC 7407]
Sequence
MRTHYCGQLRPEHIGETVTICGWVDRRRDHGGVIFLDLRDRTGIAQIVSDPERTPQSYGS
AGELRNEYVIRVTGRVSRRPDESLNAKLATGEIEIYADQIEVLNAVQRQLPFQISSAESE
TVREDLRLKYRYLDLRRDRMTRNLLLRHQVVKAVRRFLEDELNFVEVETPVLTRSTPEGA
RDYLVPSRVNPGEWFALPQSPQLFKQLLMVAGFDRYYQVARCFRDEDLRADRQPEFTQLD
MEMSFLSQEEILELNESLVCHLFKVVKGVDLPRPFPRLTYAESMARYGTDRPDTRFGLEL
VDVSDLMAESGFKVFSGAIASGGSVKVLPIPGGNDAISNVRIKPGGDLFKEVCDAGAKGL
AYIRVRENGEIDTIGAIKDNLTEEQKATLLARTGAEAGHLLLFGAGPTDIVNKSLDRLRQ
CLGRELDLIDPDKVNLLWVTDFPMFEWNADEKRLEALHHPFTAPNPEDLGDLKTARAQAY
DLVYNGLEIGGGSLRIYQRNVQERVFEAIGLSPEEARNKFGFLLEAFEYGTPPHGGIAYG
LDRLVMLLAGEESIRDTIAFPKTQQARCLLTDAPSGVDDRQLKELQVKSTYQPKKESIAQ
S
Download sequence
Identical sequences K9S6G1
WP_015170901.1.54702 gi|428224289|ref|YP_007108386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]