SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224334|ref|YP_007108431.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224334|ref|YP_007108431.1|
Domain Number 1 Region: 4-358,393-411
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.1e-106
Family B12-dependent (class II) ribonucleotide reductase 0.00029
Further Details:      
 
Domain Number 2 Region: 1067-1409
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.97e-99
Family B12-dependent (class II) ribonucleotide reductase 0.0012
Further Details:      
 
Domain Number 3 Region: 409-534,658-722
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.41e-36
Family Intein (protein splicing domain) 0.01
Further Details:      
 
Domain Number 4 Region: 733-857,1005-1065
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.98e-18
Family Intein (protein splicing domain) 0.044
Further Details:      
 
Domain Number 5 Region: 929-1022
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000000907
Family Intein endonuclease 0.074
Further Details:      
 
Domain Number 6 Region: 580-675
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000295
Family Intein endonuclease 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428224334|ref|YP_007108431.1|
Sequence length 1417
Comment ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent [Geitlerinema sp. PCC 7407]
Sequence
MVQELERSRQSGEFPENAPTAYPVFYRTYSRRTDNGRETWNAVCDRTVRGLTKLGKLTAK
ETALLLKMQQEQKALPSGRWMWVGGTEWLERPENFSGAYNCTSTNVIDWQAFGLMMDLAM
MGCGTGAILEPEYIRQLPVIRNRITVRSQGAIGTTPAAERRDLTEVLIDGNHVTLHVGDS
RQGWVKSYQTILELSSDERFDAEVTVTVDLSDVRPSGERLKGFGGVANPVKLPELYERCA
NILNKAIGRQLTSVECCLLIDEAAVCIVAGNVRRSAGMRQFAADDALGATAKDNLWQQDE
AGNWRIDPERDALRMANHTRVFHHKPTREECVEAVRKQFYSGEGAIQYAPEAIARSSADL
LTHPDIRQEFLEVYTSLGKEEARRWLKNFRPEMSDREVEHRLQRYGLNPCVTADTWVHTG
DGPRQVKDLIGVQHSTYVNGELFSTTPAGFFYSGTKDVLKLTTQEGYSLRLTGNHKVLKV
TAQTQKAQYTDWVAAETLQPGDRVLLHNHRGLQPWAGQGTLASGQLLGSLVGSDSLAQAV
VAKPALVRTQTLTRKALNSGEVASLATEFGVILDQPAVTSAIEQGSYEFYQGFLQGLFSA
HSRIQSSPTGSVSVRLAQSSLADLQAVQRMLGRLGIVSAIDARSGAQPELAIANDNLAIF
AALIGFQDPAKTAQLAEASAQYGRERFTATVASVVPDGVEAVYDCTVPGPARFDANGLVA
HNCGEILGADFHCVAGSTLLITRDGLHPIQSLVGQAVEVWNGRRWSQVVPVQTGRNRQLY
RVTFGDGTSLDVTAKHRFFVGDRFSSTYTEVTTEELSDRLTSHPYALHTEPFKIDYRDGK
FVDPTWAYTLGQLVGDGSLCKSHGKPQLQLRLYGVKSYQSLALAGRTSGTPRYYAQNPET
PCLLYTGFHENFDPEQVRALKGEAQALEALASWNREGILHFIAGLIDADGSETSSGGVRL
YVSDYDRAYRLYLLLLKCGIASSINLMAKAGSKTNLGVRKKDLWYLQITDCAAIPCQRVD
TSRGHAPKIKGKWQVIRSVEPLPGQHDSYCFNEPEFHKGVFGGTLTGQCNLSEVHLNRID
PQNLNEQAEAFTAGALSVAALLNHQFQEPRYQDSRELDPIVGVSFTGLFDFFVTAFGSDW
LRWWEAGRPDTPEGAEFRRKEAEYLSRWREIVHAAVWDYCDRHGIKRPNRCTTVQPSGTK
SLLTSAAPGWHPPKAQRYIRRITFRKNDPVALACIDFGYSVVPSQSDKDEQGNLLNDPFD
PRCTEWLVEIPVEVPWANLPGADQIDISQFSADAQFDFYMQVQRHYVTHNTSATIELREG
EIESLGDRIFQAIEGDEGYMSAALLARFDDLQTFPRLPFEPISKETYEAMLDAVKQRRAT
ADFHAALSRYDLGEMAEAGPAGCDSDKCLLPEQQPSN
Download sequence
Identical sequences K9S6J6
WP_015170946.1.54702 gi|428224334|ref|YP_007108431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]