SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224476|ref|YP_007108573.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224476|ref|YP_007108573.1|
Domain Number 1 Region: 28-149
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 9.55e-33
Family N-utilization substance G protein NusG, N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 118-210
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.41e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428224476|ref|YP_007108573.1|
Sequence length 212
Comment transcription antitermination protein nusG [Geitlerinema sp. PCC 7407]
Sequence
MTFAEDAPTNVNFSDGDAESQPNFALESRWYAVQVASGCEKRVKASLEQRIQTLDVANRI
LQIEIPQTPAVKVRKDGSRQTTDEKVFPGYVLVRMVMDDDTWLVVKNTPNVINFVGAEQR
RRTGRGRGHVKPMPLSPGEVERIFKQTQEQKPVVKVNMAAGDRIMVLSGPFKDFEGEVIE
VSPERSKLKALLSIFGRDTPVELEFNQVQKES
Download sequence
Identical sequences K9S6C6
WP_015171088.1.54702 gi|428224476|ref|YP_007108573.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]