SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224643|ref|YP_007108740.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224643|ref|YP_007108740.1|
Domain Number 1 Region: 109-258
Classification Level Classification E-value
Superfamily alpha/beta knot 1.31e-43
Family SpoU-like RNA 2'-O ribose methyltransferase 0.00047
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily L30e-like 3.53e-25
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428224643|ref|YP_007108740.1|
Sequence length 260
Comment tRNA/rRNA methyltransferase SpoU [Geitlerinema sp. PCC 7407]
Sequence
MLTSLQNPLVKQLRKLQRTKERHQQQQILLEGTHLLEEAIAAGYPLLTVCFTESWQARYP
QLWPVVAQRTDRMELVSPAVLAAIATTVNPDGVVATIARQLPSPPDLPVQLGLVLETVQD
PGNLGTIIRTAAAAGVDGLWVSEDSVDLDHPKVLRATAGQWFRLPMGVSDRLPELIEAAR
AEGIQTIATVPSARLSYWELDFRQPSLLLVGNEGAGLSEDLMALADHQVQIPLSAGVESL
NVAIATSLVLYEAKRQREHP
Download sequence
Identical sequences K9S655
gi|428224643|ref|YP_007108740.1| WP_015171255.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]