SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224665|ref|YP_007108762.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224665|ref|YP_007108762.1|
Domain Number 1 Region: 41-187
Classification Level Classification E-value
Superfamily GAF domain-like 5.45e-23
Family GAF domain 0.037
Further Details:      
 
Domain Number 2 Region: 222-289
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000432
Family Homodimeric domain of signal transducing histidine kinase 0.0028
Further Details:      
 
Domain Number 3 Region: 278-376
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000144
Family Histidine kinase 0.015
Further Details:      
 
Weak hits

Sequence:  gi|428224665|ref|YP_007108762.1|
Domain Number - Region: 450-481
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0276
Family Histidine kinase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428224665|ref|YP_007108762.1|
Sequence length 490
Comment GAF sensor signal transduction histidine kinase [Geitlerinema sp. PCC 7407]
Sequence
MVSPENRLFCRLDGLTVAAREQQRLARLTELELTEAGSIPIFEEATQTAARFLEASICVL
SIIDQKYQWFRAAVGLSHLGLMNELATSRQLLREDSLCTYVVDSHQVLAIDDTLSNGAIA
RSLLVQQYGIRSYLGAPLMSSSGHCLGTLAIFDLSPRTFTSRDAECLELIARWSVSEYER
SRYAAQTSRPPRVTPALERSLAGDLERSLQPVALTHSPNLVKVQLLNQLTQELRTPLTSV
LGMTSVLNREIYGPLTSKQKEYLNVIHCSGQYLLSLVNEILELGNLGEGSHPLSLTSVDI
EMLCQQAINSLAQAAQRQELQVSLSIEPGNRIWVLDKEKVRQVLYHLLFSVIQAANAGSI
IRVHVSRKADRLNIAIWVTHPWLGEGLPYGELYINEAAALANLSSAFENGGLASGAIAGQ
TTVTALSTPPEAIKEPNADLKTDDRENLRLLLSCYLTELHGGQISLQGTPESGYRYVIEL
PSREDLLDIS
Download sequence
Identical sequences K9S6B8
gi|428224665|ref|YP_007108762.1| WP_015171277.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]