SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224674|ref|YP_007108771.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224674|ref|YP_007108771.1|
Domain Number 1 Region: 410-633
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.57e-16
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.038
Further Details:      
 
Domain Number 2 Region: 300-389
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000314
Family Collagen-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428224674|ref|YP_007108771.1|
Sequence length 806
Comment peptidase domain-containing protein [Geitlerinema sp. PCC 7407]
Sequence
MSLADLGVTQAFFNEAYYLAQNPDVQSAVSSGAFQSGYQHFLAFGVREGRNPSAGFDAAY
YLLRNPDVAQAVQMGSFEGPFAHFALFGVEEGRSPAPELEGTNLSQVFEGGWVDRSYRNL
VLLRQLDSLVGEVGTSVTVPTAPEPAPVLVAAPVPQETGAAAVPPPPPLAQFAESTLRQF
FDEGSYLAANGDVAAAVQSGTFQNGLQHFLLFGAREGRDPGPAFDNAYYLARNPDVAAAI
RQKAFESPLEHFLLFGRFEGRSPLPPLTNPGTTAPVEPVVPPISGPTPVPSSLGALAGTR
TLRESVGDSAPQDAYQFTLASASKVSLVLDGLSANARVQILNGSGAVVATSDQPGSLAEG
INQRLGAGAYQVLVSQAAAGQNTGYNLVISGVAETTGALTNLEVTTATYLGTAGTDSASA
VEISPNREIIVAGNFNGVAQLQRLSLSGQQVLATVPLGGTMNDMDLNRSNGQIVAAGSLG
VKIYDDRANTLVRSLAIGAVDRVAVANNGNFATLSDRTITLWSAAGQAIAQTTLASRTDI
ADIAISLNGTQVYATGYTQKSADLQVPFVTAFDASLKPLWNQWDYGATTALNGGKAADSR
GVRISIGQDGGLYFLGRTDGGNSVFTWNGSSTSALGSGQLIQTDAYNTPYNLPGAITMIY
YARLDPLSGAVVKSQFALTRKGSGEGNSFGGDSITADTAGNVYIGGYAYATIANRDSTAI
AGQTVGSYSANEPAVLSVSADFSTRRYWNTFNESGASGTVNGFAVGYGRAAAFGTVKTGA
VITTASAPNPSALGGQDAFLATWSTL
Download sequence
Identical sequences K9S7I8
gi|428224674|ref|YP_007108771.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]