SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224733|ref|YP_007108830.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224733|ref|YP_007108830.1|
Domain Number 1 Region: 20-69
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000000173
Family GSPII protein E N-terminal domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428224733|ref|YP_007108830.1|
Sequence length 121
Comment hypothetical protein GEI7407_1284 [Geitlerinema sp. PCC 7407]
Sequence
MRDSSSRYHVETVSSALGGNKRLGAYLIEAGLITPAQVDVVLNDQQVTGMRFGEILATRG
WVKQQTIEYLMQKVIVPERESAKQAGIAYPDKTRQRSQPTSAPRSTSVPSSAPRDDVSWA
G
Download sequence
Identical sequences K9S6G0
gi|428224733|ref|YP_007108830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]