SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224763|ref|YP_007108860.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224763|ref|YP_007108860.1|
Domain Number 1 Region: 220-462
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.19e-70
Family Leukotriene A4 hydrolase catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 20-213
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 1.7e-48
Family Leukotriene A4 hydrolase N-terminal domain 0.00058
Further Details:      
 
Domain Number 3 Region: 556-842
Classification Level Classification E-value
Superfamily ARM repeat 5.35e-27
Family PBS lyase HEAT-like repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428224763|ref|YP_007108860.1|
Sequence length 871
Comment Peptidase M1 membrane alanine aminopeptidase [Geitlerinema sp. PCC 7407]
Sequence
MSQLLFDDNNGYKSFELPGARPHYNPDRPGQVEHIFLDLVLDLPNRSYQGTCSIRLNPVR
SNLESLTLDAVNLAIDAVKIGKTKQDFDYDGEQLHIRLSKPTQAGKPITLAIAYRVEQPQ
RGLYFVGPDKHYPHKPTQVWTQGEDEDSRFWFPCFDYPGQLATSEIRVRVPKPYQAISNG
TLLSVQEDGDDKIFHWSQQEVHPTYLMTLAVGDFAEIRDEWNGKPVTYYVEKGREEDARR
TMGKTPRMIEFFSEKYGYPYPYPKYAQVCVDDFIFGGMENTSTTLLTDRCLIDERAALDN
RGSESLVAHELAHQWFGDLVVIKHWSHAWIKEGMASYSEVMWTDAEYGPEDAAYYRLNEA
RSYLAEDSSRYRRPIVTHVYREAIELYDRHLYEKGSCVYHMIRAELGDELFWRAIHTFVQ
DNAHRTVETVDLLRAIDKATGRNLLFLFDQYVFRGGHPDYKVAYSWDGDSKLAKITVTQT
QAKDDDTSPQSGLFDLKLPIAFGFVKSSSRRKTPAQPTFQTFTVRVHEREQAFYFPLAEK
PSFVSFDQGNHFLKTVQLEYGLPELKAQLQYDPDPISRIYAAEAIAKKGGLEAVKALSEA
LKSDPFWGVRAEVAHQLGEVKLDQAFEGLRAGLKDSEARVRRAVVEALGKIKTAESYKAL
KPLVEKGDPSYYVESAAAQAIGAIAAVNSDDDKPKAEKVIKLLKSVLKERAGWNETVRSG
AIAGLSKLKTSEDALTVILEYTAPGVPQSLRLASIRALGTISSGQTKPNLERILQRLDEL
ARETFFLTQVAVAVALGQMETPKAIGVLRSLADQTPDGRVRRLAEESIQRVQKTIGSDAA
VKKMQEELDQLKKSNQELRSRLESLEAKANA
Download sequence
Identical sequences K9S6I4
gi|428224763|ref|YP_007108860.1| WP_015171375.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]