SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224839|ref|YP_007108936.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224839|ref|YP_007108936.1|
Domain Number 1 Region: 118-315
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.02e-55
Family BC ATP-binding domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 16-114
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.64e-25
Family BC N-terminal domain-like 0.0086
Further Details:      
 
Domain Number 3 Region: 321-396
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 5.96e-16
Family BC C-terminal domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428224839|ref|YP_007108936.1|
Sequence length 402
Comment 5-(carboxyamino)imidazole ribonucleotide synthase [Geitlerinema sp. PCC 7407]
Sequence
MASDPAIASSGETLAPSSAQRIGVIGGGQLAWMMAQEAGKLGMELVVQTPKDSDPAVAIA
ADRVLAAIDDAAATAQLAQQCEVITFENEFVDLDALEQLVQQGVCFRPAIASLRPLLDKY
DQRCYLQSLGLPVPRFIALEPESPPEALSQLGFPVVLKTRRHGYDGQGTFVLKSLAALTE
LWERLGRASVLLEEFVPFERELAAIACRSVSGDIAVYPIVETQQEDQVCRRVIAPAPIAA
AVAQDAQAIARTLLTGLNAVGVYGIELFLTTDGRLLVNEVAPRTHNSGHFSLDACATSQF
EQHLRAVGDRPLGSPALRSDGAVMINLLGYESSTSDYSSVRQRLAELPQAHVHWYGKTES
RPGRKLGHVTVLIDAPPEEVRSRAMAIAHTVESIWYPALVQS
Download sequence
Identical sequences K9S7Z8
WP_015171451.1.54702 gi|428224839|ref|YP_007108936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]