SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428224925|ref|YP_007109022.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224925|ref|YP_007109022.1|
Domain Number 1 Region: 84-353
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.94e-73
Family BC ATP-binding domain-like 0.000000856
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.19e-48
Family BC N-terminal domain-like 0.0000155
Further Details:      
 
Domain Number 3 Region: 332-445
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 2.3e-45
Family BC C-terminal domain-like 0.000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428224925|ref|YP_007109022.1|
Sequence length 450
Comment biotin carboxylase, acetyl-CoA carboxylase carboxyltransferase subunit alpha [Geitlerinema sp. PCC 7407]
Sequence
MRFSKILIANRGEIALRILRTCEEMGIATVAVHSTIDRHALHVQLADEAVCIGDPPSGKS
YLNIPNIIAAALTRNATAIHPGYGFLAENARFAEICADHQISFIGPSPDNIRAMGDKSTA
RETMLRIGVPTVPGSDGLVEDEKAALEIARQIGYPLMIKATAGGGGRGMRLVPEESELIK
LFLAAQGEAEAAFGNPGVYLEKFIERPRHIEFQILADSHGNVIHLGERDCSIQRRHQKLL
EEAPSPVLTPELRTKMGDAAVRVAKAINYVGAGTVEFLLDQSGSFYFMEMNTRIQVEHPV
TEMITGLDLIAEQIRIAQGEPLSLTQEQVQLNGHAIECRINAEDPDYNFRPNPGRISGYL
PPGGPGVRMDSHVYTDYEIPPYYDSLIGKLIVWGPNRTEAIARMRRALRECAITGLPTTL
NFHQRILERPEFIKGEVYTNFVLQMMQDSV
Download sequence
Identical sequences K9S733
WP_015171537.1.54702 gi|428224925|ref|YP_007109022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]