SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428225169|ref|YP_007109266.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225169|ref|YP_007109266.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Pentein 2.36e-55
Family Dimethylarginine dimethylaminohydrolase DDAH 0.025
Further Details:      
 
Domain Number 2 Region: 621-698
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0000458
Family Pyruvate oxidase and decarboxylase, middle domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428225169|ref|YP_007109266.1|
Sequence length 705
Comment bifunctional protein LOR/SDH [Geitlerinema sp. PCC 7407]
Sequence
MSTSIQILMCPPDHYDVDYVINPWMEGNIHKSSRDRAVLQWQQLYHTLKDHAIVDLLEPQ
PGWPDMVFTANAGLVLGNSVVLSRFFHPERQGEEPFFRAWFEAQGYTVHELPKDLPFEGA
GDALLDREGRWLWAGYGFRSELDSHPYLAKWLDIEVLSLRLMDERFYHLDTCFCPLVDGY
LLYYPPAFDAYSNHLIERRVPAEKRIAVSETDAVNFACNSVNVDRTVVMNQASPELRDRL
RELGFQVLETPLTEFLKAGGAAKCLTLRITEPVQVDLHAAASVESRVIQLEGHLLDSGLI
NQALDLVVEGGGSFQVLDFNLGEQRQSTSCAEIRVSAPSLVVMDKIMAQLIDLGAVAAPQ
EVCDTQLETVTQAGVAPDNFYVTTIYPTEIRVDCQWIKVQNQRMDGAIALSRTADGVVAR
CKLLRDLEVGEQVVVGVDGIRTIRKVAAREARAAQPEFGFMGSGVSSERRVELVVEQVAW
ELRHIRDQGGKVVVTAGPVVIHTGGGVHLSRLIREGYVQGLLGGNAIAVHDIEQALMGTS
LGVDMQRGVSVRGGHRHHLKAINTIRRCGSIAQAVEAGVLTEGIFYECVRNQVPFALAGS
IRDDGPLPDTQMDLLQAQTDYVRLLEGADLILMLSTMLHSIGVGNMTPAGVKMVCVDINP
AVVTKLSDRGSVESVGVVTDVGLFLSLLVRQLDRLTRPYEALRLL
Download sequence
Identical sequences K9S8X8
WP_015171781.1.54702 gi|428225169|ref|YP_007109266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]