SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225250|ref|YP_007109347.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225250|ref|YP_007109347.1|
Domain Number 1 Region: 5-60
Classification Level Classification E-value
Superfamily Hypothetical protein YjbJ 0.00000000889
Family Hypothetical protein YjbJ 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428225250|ref|YP_007109347.1|
Sequence length 60
Comment CsbD family protein [Geitlerinema sp. PCC 7407]
Sequence
MSIEDRVKATAKNVEGKIQEVVGDVTGNPQDKAEGQAKQAEAETRHTVENIKDQAKRMID
Download sequence
Identical sequences K9S833
WP_015171861.1.54702 gi|428225250|ref|YP_007109347.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]