SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428225513|ref|YP_007109610.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225513|ref|YP_007109610.1|
Domain Number 1 Region: 794-1020
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.58e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.00037
Further Details:      
 
Domain Number 2 Region: 292-496
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.4e-39
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000797
Further Details:      
 
Domain Number 3 Region: 42-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.99e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0018
Further Details:      
 
Domain Number 4 Region: 140-183,269-322
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 9.94e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.013
Further Details:      
 
Domain Number 5 Region: 711-797
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 4.19e-16
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0057
Further Details:      
 
Domain Number 6 Region: 185-266
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000275
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428225513|ref|YP_007109610.1|
Sequence length 1041
Comment CzcA family heavy metal efflux pump [Geitlerinema sp. PCC 7407]
Sequence
MLNTLLKWSILQRWLVVIGAIVVTLLGFYSLQRMPLDVFPDFAPPQVEIQTEAPGFAPEE
VESLVTLPIESAVNGTPGVETVRSSSAVGLSVVKVIFRWGTDVYQARQLVTERLQEAREK
LPEGVAPPLLSPVSSPIGTILQYAFTAEETSLMTVRRIVDRDITNRLLAVPGVSQVIAYG
GDVQQYQVLVDPAKLVAFDVSLQEVTEAAAGANVNAAGGFLTGPDQELIIRGIGRLESLD
DLAQSAVTARNGVPVRLADVATVTQGAALPRGDASWNGQRAIAVMVNKQPDADTPTVTRA
VEAAMEALTASLPEDVQVAVTFRQSDFIDAAIANVRDSLRDGIVIVSVVLLLFLMNWRTA
LISLCAIPLSLLIGLMILKAFGLGINTMTLGGLAVAIGSVVDDSIVDVENAYRGLRRNQL
ADNPLPPDQVVYDTSVEVRVSVLFSTVIIGVVFAPIFTLTGIEGRIFAPMGVAYLVSIFA
STLVALTLSPALCSILLTRRSLPTDETWVTALAQRLYRPALGLAVGRPSLILAIAGGALV
ASLVLLPSLGRVFLPEFQERSLVNAMLLYPGVSLETTNRAGLALQAALKDDPRFSSVQLR
SGRAPGDADAGGVNLGHLDVELSDVGIADREGSIAKLRAEFAKLPGVAPSIGGFISHRMD
EVLSGVRSAIAVKIFGPELPELRRLGQSVQAAMADLEGIVDLQLEPQVPIRQVQIQFERD
AAARYGLSVGELAEVVETALNGRVVSQVLEEQQLFDLVVWLEPEARRDLDTIRNLLVDTP
AGPKIPLGQLAQIRYGTGPNTINRENVSRLIVVSANVAGRDLGSVVDALRDRLQSSISLP
PGYFIQYGGQFESEQRATQNLLLFGGMAIAVIGVMMYFAVKSVPATIMILLNLPLAIVGG
IVSVAVGGGILSVASLVGFITLFGVAVRNGLLLVDNYNSKIAQGLSLHEVITEGSMERLA
AILMTALTSALGMAPLVLGTGAGKEILQPLAVVVLGGLFTSTALTLLVLPALYARFGRWL
MPQRSTVEIDTRSASVPETSF
Download sequence
Identical sequences K9S8L7
gi|428225513|ref|YP_007109610.1| WP_015172124.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]