SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428225560|ref|YP_007109657.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225560|ref|YP_007109657.1|
Domain Number 1 Region: 298-500
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.7e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000371
Further Details:      
 
Domain Number 2 Region: 809-1028
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.62e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000582
Further Details:      
 
Domain Number 3 Region: 567-671
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 9.16e-34
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0004
Further Details:      
 
Domain Number 4 Region: 138-183,276-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.19e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.001
Further Details:      
 
Domain Number 5 Region: 39-132
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.8e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000826
Further Details:      
 
Domain Number 6 Region: 184-274
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.01e-22
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00031
Further Details:      
 
Domain Number 7 Region: 723-807
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.14e-22
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428225560|ref|YP_007109657.1|
Sequence length 1060
Comment hydrophobe/amphiphile efflux-1 (HAE1) family transporter [Geitlerinema sp. PCC 7407]
Sequence
MFVEFFIKRPVFTTVCALIILLIGIVSIPALPVAQYPDISPKQVTVTTNYGGADAQTVEN
AVTTILEQEINGVEGLRYITSSSSNDGTSAITVTFDSSRDQDIAAVDVQNRVSIAEPRLP
EEVIRSGVSVSKQSSSLLLGFGLYTDNNEYDDIFLSNYADLYLVNALKRVEGVGNVQIFG
ERTYAMRIWLNPDQLASRNLTAQDVVNALREQNIQVGAGRIGQPPVPDDQRYQVDLRAVS
RLRNVSEFEDIVVTTGDNGALVKLSDVGRAELGAENYGSFLRFRGKPAVGLGINQIPGSN
AIDVARAVKAEMATLAEDFPPGMKYDIGFDTTDYVEQSLSEVILTLIQSVLLVVLIIFIF
LQDWRTTIIPAVTIPISLVGTFAFIKIFDFSINSLTLFGLTLATGMVVDDAIVVVEDIAT
KIQERGLKPRQAAIVAMQELTGAVIATSLVLMAVFIPVAFFPGTTGALYRQFALTIAFSI
AISTFIALTLTPTLSGLLLRANVQVGGWLGQIFGVFNRFLDWVRNRYRQILGFLTQVKYL
VLAGFAGLLALTFWLYQTVPSAFLPEEDQGYVIVLIQGPEGVSISYTSDVMRQVEEIMLG
LPEVNATFAVGGFGFSGSTANSGVVFTTLKPWSERKDPSQSAPAIIGRIQGQLLSIPEAR
VFPVNPPAIQGLGSFGGFQFQLQDQRGNLDLDMLVQYMGQMLGAANQHPDLRAVFSTYSA
STPQLLVEVNRDKAKALDVNINDIFATLQTYLGSQYVNDFNLDRRTYRVYVQADAQFRTN
PDTIDQLYVRSQRDQMIPLGNLVTVTPATGAQTINHYNLFRSIEISGSPAPGASSGDAIR
AMESVAAKVLPTGVGYEWSGTSLEEIESGGQAPLIFGLGLVFVFLVLAAQYESYIDPTII
MLSVPLAIMGALAAQMLRGFANDVYCQIGLVMLIGLASKNAILIVEFANQLREEGLSITS
AALEASQQRLRPILMTAISTLVGIFPLVIATGAGAGSRQSLGTAVFGGMFIATFLSLFLV
PILYIVIKTLTEPTRPQGPRHTEDDGAQPKLESESSSRSY
Download sequence
Identical sequences K9S8W9
WP_015172171.1.54702 gi|428225560|ref|YP_007109657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]