SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428225913|ref|YP_007110010.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225913|ref|YP_007110010.1|
Domain Number 1 Region: 313-612
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.83e-87
Family DNA repair protein MutS, domain III 0.00000138
Further Details:      
 
Domain Number 2 Region: 614-850
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.85e-59
Family ABC transporter ATPase domain-like 0.000000943
Further Details:      
 
Domain Number 3 Region: 149-213,243-325
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.02e-41
Family DNA repair protein MutS, domain II 0.00034
Further Details:      
 
Domain Number 4 Region: 38-147
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 5.89e-37
Family DNA repair protein MutS, domain I 0.0000592
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428225913|ref|YP_007110010.1|
Sequence length 892
Comment DNA mismatch repair protein MutS [Geitlerinema sp. PCC 7407]
Sequence
MTVSPEAFGPDASDGLPERRAKAINSLTDHRLADRELLTPMMRHYADLKDDYSHALLLYR
VGDFFECFFQDAVAVARELELVLTSKEGGKDIGRVAMAGVPYHALDRYCAQLVEKGYAVA
ICDQMEYASQAQGLVRREITRVMTPGTVLEEGMLNARRNNFLAAVVLAGSAWGLAVADVS
TGEFLTTQASDLEQLTQELMRLQPSEVLVPTNAPDLGGLLRPGERSSHLPDCLPTQFCYA
LRSQASFALPEARQRLLEWLRVRSLEGMGCDHLPLAVRAAGGLLAYLEDTQRETPVPLQT
LRTYALTDYLILDHQSRRNLEITQTVRDGTFHGSLLWALDRTVTAMGSRMLRRWLLQPLL
KVEAIAQRQETLQELVDNGTLRQDLQALLRDIYDLERLAGRAGSGTANARDLVALADSFG
RLPDLATLVAQGRSPYLQALQSVPPVLEQLGHTLKAHLVESPPLSLTDGNLIRSGVNADL
DTRRSQIEDDQIWINNLEKSERDRTGVSTLKVGYNKTFGYYISISRAKADQVPDNYLRKQ
TLTNEERYITPELKEREARIFSARDDLNQLEYEIFAALRTQVGEQAALIRQVAQAVAAAD
VLCGLAEVAVYRGYCRPQLGEGRTIAVEAGRHPVVEQSLPAGFFVPNSTHLGDRGVTAPD
LIVLTGPNASGKSCYLRQVGLIQLMAQVGSFVPATSATLGICDRIFTRVGAVDDLATGQS
TFMVEMNETANILNHATPQSLVLLDEIGRGTATFDGLAIAWSVAEYLAGEIGARTIFATH
YHELNELASLLPNVANYQVVVKELPDQIVFLHQVQPGGADRSYGIEAGRLAGLPAVVIQR
ARQVMSQIEKHSKIAVGLRKTSAIADKPEKNGRSPSPSASENRPEQLDIFGG
Download sequence
Identical sequences K9S9R9
gi|428225913|ref|YP_007110010.1| WP_015172522.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]