SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428225987|ref|YP_007110084.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225987|ref|YP_007110084.1|
Domain Number 1 Region: 12-254
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 3.92e-61
Family YjeF N-terminal domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 239-511
Classification Level Classification E-value
Superfamily Ribokinase-like 6.16e-60
Family YjeF C-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428225987|ref|YP_007110084.1|
Sequence length 521
Comment carbohydrate kinase [Geitlerinema sp. PCC 7407]
Sequence
MQDRAAQLQTFVVTAQQMRAIESRVFAAGMPVAALMEKVAGQVARRIQVLYPQPATRRVG
VLVGPGHNGGDGLVVARELLFRGYEVRLWQPIAKLKDLTAQHARYVQSLGASVSDRPESL
DGVDLIVDGLFGFGLERPIDGDLAAAIAHLNALPCPVVSIDLPSGLHTDTGEALGTAICA
DRTLCLGLWKLGLLQDRALAFVGETELVDFDLPLADIAAVLSESPGLRRITPEVALSGLP
LVRQPSTHKYRQGHVLLVCGSRQYLGAMLLTALGARATGVGMVSMAVPESAKPWLVSRLP
EVVAYGCPETESGAIAQLPSLDLAKFQAIACGPGLTLDAAGVMRTLLESDRPLVLDADGL
NLLAQIDPIATLRSRSAPTVLTPHTGEFQRLFPETGWDRENRPQAAQAAAQATGATILLK
GARTAIASPQGPVWINPESTPALARGGSGDVLTGLIGGLMAQGLAKGIAPEASVRSAAWW
HAQAACRAAQERTVLGVDPVTLTEALIPTLRDWAAIARPPM
Download sequence
Identical sequences K9S8S6
WP_015172596.1.54702 gi|428225987|ref|YP_007110084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]