SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428226008|ref|YP_007110105.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226008|ref|YP_007110105.1|
Domain Number 1 Region: 149-298
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.06e-39
Family Pentapeptide repeats 0.00032
Further Details:      
 
Domain Number 2 Region: 32-189
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 7.06e-37
Family Pentapeptide repeats 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428226008|ref|YP_007110105.1|
Sequence length 438
Comment pentapeptide repeat-containing protein [Geitlerinema sp. PCC 7407]
Sequence
MQKYPKDKAAKVKKIQELYASGVRDFSSQEDDLNLDGVDFTGVDLQDANLSYLSMIKSKI
VGANFSRVDLSDNNLTEADLSETNLSSANLGYSCLHRAKLDKAVLSDAKLDNAELNDASL
REANLQGADLCNSKLINVDFRGADLRNTNLSDIDAKGANFEDADLREANLGQALLCGANL
DKIILPNANLACVDFSNASLQEADLQGANLTDSSFVNVDFRNVKLSNANFFRAELKGANF
ENVDLREVNLENSILINANLRGSNLCNVNLSYADLKGANFENADLRGADLDGVRYDETTQ
FPEDIHPSSYQGLWLDEDTFVKYDCIDRIRIAKSWDRFSDLMLDMGFGEEVSKMVKTVDD
DSTDDWFDDSNDDCYSYRHDIEFKDVNIRLSDLQDLDWDYVVIKSSTSLDGYDFGYLSSA
IKEAVESGDIELEIYLYT
Download sequence
Identical sequences K9SA11
WP_015172617.1.54702 gi|428226008|ref|YP_007110105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]