SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428226252|ref|YP_007110349.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226252|ref|YP_007110349.1|
Domain Number 1 Region: 43-313
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.18e-100
Family Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) 0.000000805
Further Details:      
 
Domain Number 2 Region: 316-542
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.46e-39
Family Nucleotide and nucleoside kinases 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428226252|ref|YP_007110349.1|
Sequence length 546
Comment pantothenate synthetase, cytidylate kinase [Geitlerinema sp. PCC 7407]
Sequence
MVRLFSTVAALRCYLDQYRLQPESTDSSQTQRNFSGPGRDTFPQRTIGLVPTMGALHAGH
LSLIQRSRQDNDLVVVSIFVNPLQFGPSEDFARYPRTLEQDMALCREAGVDVIFAPTVEE
LYGDRVSSTQMLVGRTQVLPPADMTQVLCGRSRPGHFHGVTTVVTKLFNLVQPTRAYFGQ
KDAQQVAILRRMVHDLNQPVEVVVCPIVRESSGLALSSRNQYLSPQERDDAAVLYRALQA
AVQVVRQGTYGREAILTAVKREIATVPAVELEYIELVDPVILKSLDTVQDSGLLAIAARL
GNTRLIDNVVLRNRQPIVAIDGPAGAGKSTVTRRVADALGLTYLDTGAMYRAVTWLALTT
ETAIDDEPAIAEMVYRCQIEFRLGEADATSGAIAGQRVFINGEDVTTAIRSPQVTAQVSA
IAAQPAVRQGLMEQQRAYGLHGGLVAEGRDIGTHVFPDAELKIFLTASVQERARRRQIDL
KNQGHGDIDLDELERAIYERDYKDSTRESAPLIKAPDAIEIQTDGLTIADVVNQIVGLYQ
ERCVQV
Download sequence
Identical sequences K9S9L5
gi|428226252|ref|YP_007110349.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]