SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428226328|ref|YP_007110425.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226328|ref|YP_007110425.1|
Domain Number 1 Region: 3-243
Classification Level Classification E-value
Superfamily Hsp33 domain 1.05e-67
Family Hsp33 domain 0.00000282
Further Details:      
 
Domain Number 2 Region: 235-293
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 4.32e-19
Family HSP33 redox switch-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428226328|ref|YP_007110425.1|
Sequence length 300
Comment Hsp33 protein [Geitlerinema sp. PCC 7407]
Sequence
MADQLIRATAADGGIRAVGVVTTRLTEEARKRHQLSYVATAALGRTMAAGLLLASSMKSN
ESRVNIRVKGNGPLGGVLVDAGLDGTVRGYVDNPDVELPPNQRGKLDVGGAVGSDGYLYV
VRDVGYGYPYSSTVELISGEIGDDVSHYLVNSEQTPSALLLGVFVGSEGVTASGGLLLQV
MPKAARDEALVATLESRVGSLSGFTPLLKAGKSLPEILEDLLGDMSLTLLPETRMLRFHC
GCSFDRMIGALKMLGEAELQDMLEQDRGAEATCHFCAEVYRATEADLERLLSDLRTESQS
Download sequence
Identical sequences K9SAY7
WP_015172937.1.54702 gi|428226328|ref|YP_007110425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]