SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428226383|ref|YP_007110480.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226383|ref|YP_007110480.1|
Domain Number 1 Region: 26-191
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 4.55e-28
Family MJ1460-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428226383|ref|YP_007110480.1|
Sequence length 220
Comment 4-vinyl reductase 4VR [Geitlerinema sp. PCC 7407]
Sequence
MISVADLLVDNRIPGNYFAADAYVRSDLELGLLENRRGDRLLAMPETLVRAIYAGLDRET
GMASRLVLFNCGRWWGKSFYSRFCEELSSYYNQAVADMPMIEFLQSLQQCWVTHGWGKID
LDQSYQKNGFLVIQIWNSPFARHALDSPHPVCYLEAGVLSTFFSQLTGRELHCVQTTCES
QGADCNRFVLGLEPRVRPAEALVEQKQDHAVIMQSLCAQA
Download sequence
Identical sequences K9SB42
gi|428226383|ref|YP_007110480.1| WP_015172992.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]