SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428226490|ref|YP_007110587.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226490|ref|YP_007110587.1|
Domain Number 1 Region: 15-261
Classification Level Classification E-value
Superfamily Folate-binding domain 1.26e-61
Family Aminomethyltransferase folate-binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 265-340
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000311
Family Aminomethyltransferase beta-barrel domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428226490|ref|YP_007110587.1|
Sequence length 350
Comment folate-binding protein YgfZ [Geitlerinema sp. PCC 7407]
Sequence
MDMQQAAETSLQGEPPVAASFGNDSAARQAALKGVAVCDRSHWGRIEIAGGDRVRYLHNQ
STNDFQRLQSGEGCDTVFVTSTARTLDLATVYVLETHFLVLVSPQRHQQILAWLDRYIFP
MDQVSLKDCTSDTAVLSLIGPESQALLAGLGLPVPDGPHGQHLSGTLGKAEVRVAVGSGL
AAPGYTLICTAQDRAALWQGLVAAGAVPMGDRAWEQLRIEQGRPAPDCELTEDYNPLEAG
LWHTISFNKGCYIGQETIARLDTYKGVKQQLWGLRLSQPVEPGTPILLNDEKVGLVTSVT
EASEGAIGLGYVRTKAGGAGLTAQAGEAIAEVVEIPFVTRDRSAALGVSS
Download sequence
Identical sequences K9SBK7
WP_015173099.1.54702 gi|428226490|ref|YP_007110587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]