SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428226649|ref|YP_007110746.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226649|ref|YP_007110746.1|
Domain Number 1 Region: 380-577
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5e-67
Family Pyruvate oxidase and decarboxylase PP module 0.0000168
Further Details:      
 
Domain Number 2 Region: 196-371
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.8e-65
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000279
Further Details:      
 
Domain Number 3 Region: 5-186
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.2e-65
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428226649|ref|YP_007110746.1|
Sequence length 609
Comment acetolactate synthase large subunit [Geitlerinema sp. PCC 7407]
Sequence
MQSVATRRVTGAYALLDSLKRHGVKHIFGYPGGAILPIYDELYRVEAEGSIKHILVRHEQ
GAAHAADGYARATGQVGVCFGTSGPGATNLVTGIATAHMDSIPLVVITGQVPRTAIGSDA
FQETDIFGITLPIVKHSYVVRDPRDMARIIAEAFHIASTGRPGPVLVDIPKDVGFEEFDY
VPVEPGSVRLPGYKPTVKGNPRQVNQALNLIQEASRPLLYVGGGAIAASAHDEIRELAER
FRIPVTTTLMGKGSFDENHELGLGMLGMHGTAYANFAVSECDLLIAVGARFDDRVTGKLD
EFAARAKVIHIDIDPAEVGKNRSPEVPIVGDVRQVLTELLRRSRERGDTPNAQQTREWLE
RIDRWRQDYPLQVPQYPDVLSPQQVIVELGRQAPNAFFTTDVGQHQMWSAQFLKNGPRRW
ISSAGLGTMGFGLPAAMGAKVACPEEQVICVSGDSSFQMNLQELGTLAQYGINVKTVIVN
NGWQGMVRQWQQAFHGERYSSSNMEVGMPDFVVLAQAYGIKGLIVEDPADLTGAIAEMLT
HDGPVLMDVRVRRDENCYPMVAPGKSNAQMIGLPERNPLDAAAELVYCSNCGAKNISSNN
FCPECGTKL
Download sequence
Identical sequences K9SD36
gi|428226649|ref|YP_007110746.1| WP_015173258.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]