SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428226695|ref|YP_007110792.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226695|ref|YP_007110792.1|
Domain Number 1 Region: 182-642
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.46e-119
Family Amylase, catalytic domain 0.0000000045
Further Details:      
 
Domain Number 2 Region: 650-753
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 9.89e-38
Family alpha-Amylases, C-terminal beta-sheet domain 0.00027
Further Details:      
 
Domain Number 3 Region: 15-117
Classification Level Classification E-value
Superfamily E set domains 2.66e-16
Family E-set domains of sugar-utilizing enzymes 0.011
Further Details:      
 
Domain Number 4 Region: 141-199
Classification Level Classification E-value
Superfamily E set domains 0.000000049
Family E-set domains of sugar-utilizing enzymes 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428226695|ref|YP_007110792.1|
Sequence length 767
Comment glycogen branching protein [Geitlerinema sp. PCC 7407]
Sequence
MALTVASEQIDRIVWNQHHDPFEVLGPHPVQHEGKNAWAVRAYLPTAEAAWVLLPEQRKE
YPMQVSHHPHFFECILEVETLGNYQLRIQEGEHERVTYDAYAFRSPWLTELDTYLFAEGN
HHRIYEKMGAHATEVEGVQGVHFAVWAPHARNVSVIGDFNVWDGRKHQMRRGGAGIWELF
VPELKVGDRYKYEIKNNDGHIYEKSDPYGFQQEARPKTASIVADLDSYQWSDSSWMETRR
HTEPLTQPVSVYEVHLGSWLHASAETPPTLPNGETEPVVIVSDYKPGARFLTYRELADRL
IPYVKELGFTHVELLPIAEHPFDGSWGYQVTGYYACTSRYGTPQDFMYFVDQCHKNGIGV
IVDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLVFNYGRHEVRNFLVANALF
WFDKYHIDGIRVDAVASMLYLDYCREPGEWLPNQYGGRENIEAADFLRQVNHVIFSYFPG
ALSIAEESTAWPMVSWPTYVGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNVTFSIW
YAFSENFMLALSHDEVVHGKSNMPGKIPGDEWQKFANLRCLYSYMYLHPGKKTLFMGMEF
GQWSEWNVWGDLEWHLLQFAPHQTLKHCITKLNELYRSESAIYTQDFSQEGFEWIDCNDN
RHSVVSFIRRAKDSDEFLVVVCNFTPQPHAHYRIGVPEHGFYEELFNSDSREFGGSNMGN
LGGKWADEWSFHSRPYSLDLCLPPLSTLVFKLNREKTARAIAPGTDN
Download sequence
Identical sequences K9SC72
WP_015173304.1.54702 gi|428226695|ref|YP_007110792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]