SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428226780|ref|YP_007110877.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226780|ref|YP_007110877.1|
Domain Number 1 Region: 142-361
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.58e-53
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000772
Further Details:      
 
Domain Number 2 Region: 445-585
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.4e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000372
Further Details:      
 
Domain Number 3 Region: 11-141
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.1e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.0042
Further Details:      
 
Domain Number 4 Region: 362-436
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.8e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.003
Further Details:      
 
Domain Number 5 Region: 588-640
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000815
Family CopG-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428226780|ref|YP_007110877.1|
Sequence length 642
Comment sulfite reductase (ferredoxin) [Geitlerinema sp. PCC 7407]
Sequence
MAKSSTQTPPAQKLSKVEGIKERSHFLREPVASELLLDTTHFSEDGVQILKFHGSYQQDN
RDNRVKGQEKDYQFMLRTRSPGGFIPAQLYLTLDKLSDEYGNGTLRATTRQGFQIHGILK
KNLKTVMAAIVRNMGSTLGACGDLNRNVMAPPAPFKNQVAYDYARTYANNVADLLTPQTG
AYYEIWLDGEKVLSGEEAPEVKAARQRNGNGTLIASNEEPIYGTHYMPRKFKCAVTVPGD
NSVDLFSQDVSLVVITNKKGKLEGFNVYAGGGLGRTHNKEETFARIADPIGYVDQADVYD
LIKAIVATQRDYGDRANRRHSRMKYLLHDWGVEKFRQQVEGYFGKKIKPLKALPPFEYQD
YLGWHDQGDGKLFFGLSIENGRVKDEGSFKLKTALRKIVETYQLPIYLTPNQNLLLCDIE
PQQQREIQAILDRSGILKETEIDPLVRYSMACPALPTCGLAITESERILPSILERIRAVL
AKVGLEQEHFVVRMTGCPNGCARPYLAELGLVGSAPNSYQVWLGADPHQTRLSAPYIERM
AEDDLEATLEPLFVYFKQEQQQRPQPESFGDFCHRVGFDALRQFAATYQSAPAAPAATNG
KSRPRVSLAPSTYERLKEAATTQGKPMTELVNEAIEAYLRDR
Download sequence
Identical sequences K9SCF7
WP_015173389.1.54702 gi|428226780|ref|YP_007110877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]