SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428226928|ref|YP_007111025.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226928|ref|YP_007111025.1|
Domain Number 1 Region: 24-135
Classification Level Classification E-value
Superfamily ARM repeat 8.64e-21
Family PBS lyase HEAT-like repeat 0.011
Further Details:      
 
Weak hits

Sequence:  gi|428226928|ref|YP_007111025.1|
Domain Number - Region: 156-230
Classification Level Classification E-value
Superfamily ARM repeat 0.000691
Family RPA1889-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428226928|ref|YP_007111025.1|
Sequence length 279
Comment PBS lyase HEAT domain-containing protein repeat-containing protein [Geitlerinema sp. PCC 7407]
Sequence
MTEANSPPSSPSLVDSSGEALTVDQAIANLKHPDLSLRYYAAWWLGKFSEGDPQVVDALI
AALEDEDDQTELGGYPLRRNAARALGKLGDRRAVLPLVRCLDCTDFYVQEAAAQSLGMLG
DPVCVPDLLRFLEGGVAAALQVPGRPHLARPVEGVIEALEALDARDAVPLVRPFLDHPVE
RVACMAARAMYALTQEAPYGDRLVQALGCDDVKLRRIILMDLGTSGYLAGAEAIASASVE
SSFKIIALKSLLDNHFKRSQSVVLSEAACQVMALMDALL
Download sequence
Identical sequences K9SCP5
gi|428226928|ref|YP_007111025.1| WP_015173537.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]