SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428227083|ref|YP_007111180.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428227083|ref|YP_007111180.1|
Domain Number 1 Region: 17-507
Classification Level Classification E-value
Superfamily ADC synthase 6.41e-159
Family ADC synthase 0.000000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428227083|ref|YP_007111180.1|
Sequence length 512
Comment anthranilate synthase, component I [Geitlerinema sp. PCC 7407]
Sequence
MIFPDFSQFAAMADQGNFVPVYQEWVADLDTPVSAWYRVCAGQPYSFLLESVEGGEKIGR
YSLLGCDPLWVLEARGDRTTQTYRDGSVQVFEGDPFTALKDCLAPFHPVKLPQLPPGIGG
LFGFWGYELINWIEPRVPIYPSAEGDLPDGLWMQVDNLLVFDQVKRKIWAIAYADLRDPN
VDLRSAYDQACDRVRQLVAKLQLPLSGSDTLLSWQPPTTEGLPPLSYRSNTEKEQFCANV
QAAKDHIRAGDIFQVVLSQRLEAQYTGDPFALYRSIRLINPSPYMAYFHFRDWQIIGSSP
EVMVKADRADEASDIMQAIVRPIAGTRKRGATPTEDADLAADLLQDPKEIAEHVMLVDLG
RNDLGRVCVNGTVRVDELMVIERYSHVMHIVSNVVGTLAPGKTAWDLLKACFPAGTVSGA
PKIRAMQIINELEPCRRGPYSGAYGYYDFEGQLNTAIAIRTMVVRSNGDGSHTVRVQAGA
GLVADSEPEKEYEETLNKARGLLEAIRCLHPA
Download sequence
Identical sequences K9SD50
gi|428227083|ref|YP_007111180.1| WP_015173692.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]