SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428225236|ref|YP_007109333.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225236|ref|YP_007109333.1|
Domain Number 1 Region: 46-470
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.4e-117
Family GABA-aminotransferase-like 0.000000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428225236|ref|YP_007109333.1|
Sequence length 481
Comment diaminobutyrate acetyltransferase [Geitlerinema sp. PCC 7407]
Sequence
MQQIQHGPGTLAPTPGEALAPWSYPEPENTLPGPRSLPYLERQAQRESNARSYPRRIPLA
IREAQGIYVTDADGQRYIDCLAGAGTLALGHNHPVVIEAMQRTLASKSPLHTLDLTTPIK
DEFVSALFDSLPAEFAQRARVQFCGPSGADAVEAAVKLVKTATGRRSMLSFQGGYHGMTH
GALSLTGNLGPKTAIAGLMGEVHFLPYPYAYRCPLGLGGELGHRAISRYIENLLDDPESG
VVKPAGIILEVVQGEGGVIPAPVEWLRELRRITRDRQIPLIIDEIQTGWGRTGKLYAFEH
AGITPDVVLLSKAIGGSLPLSVVLYDQSLDQWGPGAHAGTFRGNQLAMAAGTATLQYLQE
HHLVEQAQTLGDRLMAHLYQVQAEFPALGEVRGRGLMVGVEVVNRAATPNFQGSYPAHPA
LARHIQAECLRRGLILELGGRHGSVVRFLPPLIVTATDIDRIADIFHSAVTAATESLEAA
A
Download sequence
Identical sequences K9S8L9
gi|428225236|ref|YP_007109333.1| WP_015171847.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]