SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428225638|ref|YP_007109735.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225638|ref|YP_007109735.1|
Domain Number 1 Region: 149-315
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 5.1e-49
Family Succinyl-CoA synthetase domains 0.0000147
Further Details:      
 
Domain Number 2 Region: 513-729
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.32e-39
Family BC ATP-binding domain-like 0.077
Further Details:      
 
Domain Number 3 Region: 314-475
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 9.68e-39
Family Succinyl-CoA synthetase domains 0.0002
Further Details:      
 
Domain Number 4 Region: 16-159
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.37e-38
Family CoA-binding domain 0.00026
Further Details:      
 
Domain Number 5 Region: 762-910
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.93e-21
Family N-acetyl transferase, NAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428225638|ref|YP_007109735.1|
Sequence length 922
Comment CoA-binding protein [Geitlerinema sp. PCC 7407]
Sequence
MQTTPRTTDPANDILRTDRQPLDAIFRPRAIAVIGATEREGSVGRTLLWNLITNAFGGTV
FPVNPKRNSILGIKAYPSIAAVPDAVDLAVIATPAATVPGVLRECVAAGVKGAIVLSAGF
KEIGAEGLRLEQEVLQEIRRGKMRLIGPNCLGVMNPLTGLNATFASAMARPGNVGFISQS
GALCTAILDWSFRENVGFSAFMSIGSMLDVGWGDLIYYLGDDPHTHSIVIYMESIGDARS
FLSAAREVALTKPIIVIKAGRTEAAAKAAASHTGALAGSDAVLDAAFRRCGVLRVDHISD
LFDMAEVLAKQPRPKGPRLTIITNAGGPAVLATDALIGSQGELTPLSEEAIATMSEFLPP
FWSHANPIDILGDADPDRYLKTLAVAADDPESDGLLVILTPQAMTDPTQTAEQLKTFLKT
QKPVHAKTRKPILASWMGGADVSAGELILNGAGVPTYPYPDTAARVFSYLWRSSYNLRGI
YETPTLPSDDDAPDRAQVAAVLEQVRAAGRTLLTEGEAKQVLAAYGIPTVETRIARTVEE
AVAHAEAIAYPAVLKLFSETITHKTDVGGIKLNLPDADAVRRAYGEIQTSVTERAGAEHF
QGVTVQPMIKLDGYELIIGSSLDPQFGPVLLFGSGGQLVEVMQDRAIALPPLNTTLARRM
MEQTRIYKALQGVRGRTASDLAALETLLVRFSRLVVEQPWVQEIDINPLLVRSADAPAPL
LALDARMVLHPASTRLEDLPKLAIRPYPSRYVAPWRLKNDLEITIRPIRPEDEPLMVDFH
ESLSEESVYFRYFHLMKLSHRVAHERLTRMCFIDYDREMALVAEYHNPETQKPQLLAIGR
LSKLHGTQDAEFAMLVSDRWQCQGLGSELLRRLVQVGRDEHLQRITAEILSDNQGMQHVC
TKLGFQLQPTADPSVMFVSIDL
Download sequence
Identical sequences K9S8Z9
gi|428225638|ref|YP_007109735.1| WP_015172249.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]