SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428226543|ref|YP_007110640.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226543|ref|YP_007110640.1|
Domain Number 1 Region: 227-363
Classification Level Classification E-value
Superfamily CBS-domain pair 1.14e-26
Family CBS-domain pair 0.0032
Further Details:      
 
Domain Number 2 Region: 371-454
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3e-19
Family CorC/HlyC domain-like 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428226543|ref|YP_007110640.1|
Sequence length 522
Comment hypothetical protein GEI7407_3120 [Geitlerinema sp. PCC 7407]
Sequence
MDASVLVAASASISLSGQDVALRLLSVLLLIAINAFFVAAEFSIVSVRRSRINQLVAAGD
LQARTVQHLQRGIDRLLSTTQFGITLSSLALGWIGESTMSVLVAAWMRQWPLPPATADSL
AHALAIPVAFFAIAYLQIVLGELCPKSVALLYAEELARFLGPASLTIARLFNPFIWALNQ
STRWLLRLVGIQYTGQGWYNRVTPEELQLIISTSSESTGLEAEERELLSNVFAFGEVTAV
EVMVPRTSVVAVPEKATFQTLLEEIAISGHSRYPVTGDSLDDIRGIIYFKDLAAPLAQGE
ITPDTPIQPWIKPARFVPEYVPLNELLALMQRSRQVMVVVVDEFGGTAGLISIKDLIAEI
IGDGGEAENPEELSFQMLDEQTFLVQAQLHIEEVNELLSLDLPLIDEYQTLGGFLIYEMQ
KIPMEGDSFRYHNLEFTLVSADGPRLHQIRVHRIELEPTSAFEDVTDLLDEMPAVSEGSP
ASAEAADGLPPEFQTSDRPEASLDLPPESPPEPAPDSPEPER
Download sequence
Identical sequences K9SBJ7
gi|428226543|ref|YP_007110640.1| WP_015173152.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]