SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392412980|ref|YP_006449587.1| from Desulfomonile tiedjei DSM 6799

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392412980|ref|YP_006449587.1|
Domain Number 1 Region: 172-566
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1e-90
Family beta-Lactamase/D-ala carboxypeptidase 0.000045
Further Details:      
 
Domain Number 2 Region: 55-212
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.79e-36
Family Penicillin binding protein dimerisation domain 0.0015
Further Details:      
 
Domain Number 3 Region: 597-650
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392412980|ref|YP_006449587.1|
Sequence length 655
Comment cell division protein FtsI/penicillin-binding protein 2 [Desulfomonile tiedjei DSM 6799]
Sequence
MYRKPKSVNWEVYRILLVAVFFAAGTLYLVVQAYKLQIADAEYLQKLAEKQRTMVIHLEA
RRGMILDKSGEQMAASLEVNSIYAKPKRVTDKKVSAKTLAEILEISEKEILQKLDDDRTF
VWIARRVSPIIAEKVIKAHLPGIETSTEYQRFYPLKSFAAHAIGFAGIDSKGLEGLELNY
DDDLKAEPIPITAQRDALGRPVMFTSVGQDPNRRDLHLTLDRNIQYIVEKELDQTVEKEQ
AKSGTVVVMNADTGEILALAVRPTYNLNVFQKVPAEVRRNRAVADTFEPGSTFKVFLAAA
ALDLGRVTAGEMFDCRNGIYKYNGAEIHDIVPYKKLSFEDVIIHSSNIGAVRISEQLKKT
EFYAILAAFGFGSPTGVDLPGERPGMLAMPAKWSVLTKANISFGQGISLNAVQLASAFAA
AINGGSLYQPHLMKSVTNAVGETIRENSPVLVRKVIKESTSEKIVEILRGVVDRGTGRAA
AIPGADVIGKTGTAQKADPAGGYSPDKYVVSFVGALMSVKPRLVIYVVIDEPAGKNRTGG
KVAAPLFRRIGEAVLSLCGSKPSAPEIILASSSGGFQKPVSLPRSVHVRKGSKPGEWIVP
DLKGLDMRQALEVCGKMKCDVTFQGTGQAVKQSVKPGQAIKEGAPFTVFFEGQQS
Download sequence
Identical sequences I4CCN2
gi|392412980|ref|YP_006449587.1| WP_014812431.1.2604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]