SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|488611043|ref|YP_007932379.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488611043|ref|YP_007932379.1|
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000141
Family N-acetyl transferase, NAT 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488611043|ref|YP_007932379.1|
Sequence length 205
Comment GCN5-related N-acetyltransferase [Streptomyces fulvissimus DSM 40593]
Sequence
MGRRLVPLTLDNLEDLPERCRACVFWELDPVSGEAAVKAGKPELEKEAWISAVLLEWGSC
GRVVYVDDVAVGFVLYAPPAYVPRSTAFPTSPVSPDAVQLITGLIVPGYQGQGLGRVMVQ
TVAKDVLRRGFKAIEAFGDARAEEFGCVLPADHLLAVGFKTVRPHPRYPRLRLELRTTLS
WKEDVEMALDRLLGAVQKEPVLRPL
Download sequence
Identical sequences A0A1C6NJD2 A0A233RL46 N0CUE4
gi|488611043|ref|YP_007932379.1| WP_015609847.1.15473 WP_015609847.1.6102 WP_015609847.1.90088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]