SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|488611555|ref|YP_007932891.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488611555|ref|YP_007932891.1|
Domain Number 1 Region: 16-176
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.12e-19
Family N-acetyl transferase, NAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488611555|ref|YP_007932891.1|
Sequence length 187
Comment Conventional protein tyrosine phosphatase [Streptomyces fulvissimus DSM 40593]
Sequence
MRQDRRMTNTSPIGTAAQLSFRRADEADLDELVRLRDDAARWQIERGIDQWQPGELGPEH
FRGRLREGEVWLAMLGPDGPSAGAWELWWDDGPAWGAQPPVAGYVHRLMTDRRTAPPGAG
RVLLAEAERRIAAYGRELCRLDCLTSNTRLRHYYEDAGYTVVGEQSGKAGDGGRTYGVTL
LEKRLGV
Download sequence
Identical sequences N0CS84
gi|488611555|ref|YP_007932891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]