SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488614037|ref|YP_007935373.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488614037|ref|YP_007935373.1|
Domain Number 1 Region: 4-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.09e-112
Family FMN-linked oxidoreductases 0.00000000181
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000146
Further Details:      
 
Domain Number 3 Region: 461-519,555-649
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.8e-23
Family C-terminal domain of adrenodoxin reductase-like 0.0000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488614037|ref|YP_007935373.1|
Sequence length 671
Comment 2,4-dienoyl-CoA reductase (NADPH) [Streptomyces fulvissimus DSM 40593]
Sequence
MSLYPTLLSPLDLGFTTLPNRVLMGSMHIGLEEAERGFERMAAFYAERARGGVGLIVTGG
IAPSERACSFPGGAKMTTEAEAEQHREITSAVHAAGGRIAMQILHFGRYAHHPDLVAPSA
LKAPISGFTPNALTDEQVEETVEEFVRAAELARLAGYDGVEIMGSEGYLINEFIVSATNH
RTDRWGGSYENRIRFPVEIVRRVRERVGSDFILIYRLSMLDLVPGGSTLEEVVTLAKEIE
AAGATIINTGIGWHEARIPTIATSVPRAAFTWVTEKVRGAVSVPLVTSNRINTPEVAEEV
LASGRADMVSMARPFLADPEFVAKAAAGRADAINTCIGCNQACLDHIFSLQITSCLVNPR
ACHETELVLSPTRTRKRVAVVGAGPAGLACSVTAAERGHSVTLFDTADEIGGQLNVARRV
PGKEEFNETLRYFRTRLAELDVELRLSTRADAGTLDGFDEIVLATGVEPRTPAIPGTDHP
NVVSYLDVLRDGAPVGDRVAIVGAGGIGFDVAEFLTDGGDAASLDAETFFRQWGVDTSYA
ERGGLRAPERPKTPRTVHLVQRKTTKVGAGLGKTTGWIHRTELRHRGVEMIAGASYDLID
DEGLHLTVDGERRVLPVDTVVLCAGQEPRRELYEELRAAGGPVHLIGGADVAAELDAKRA
IRQGTELAAAL
Download sequence
Identical sequences N0D5Y5
gi|488614037|ref|YP_007935373.1| WP_015612780.1.90088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]