SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488607978|ref|YP_007929314.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488607978|ref|YP_007929314.1|
Domain Number 1 Region: 67-234
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.87e-17
Family FemXAB nonribosomal peptidyltransferases 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488607978|ref|YP_007929314.1|
Sequence length 311
Comment Acetyltransf_6 multi-domain protein [Streptomyces fulvissimus DSM 40593]
Sequence
MIVRSLGLPVALVDVDQAMSGEWRDHEHQVDVVRVQDPPHHTWPWLREAGFHPKPQVIMW
RAEVLESEDTYLAALSGKDRYDIRSAYRRAGEAGLLIRTETLTPELLDQFIELYERQVAG
MRHGWAVAVHQRADILDEADTYCAVTVRSGSTLVGACLDQDLPDRQEMRARFSAVTPGQR
SDSLSRVLYWETMREARLRGRRWATLGRDVNLYGHLGNAGLFSFKSRLGFTAVPGQLVEP
GTGSHQADRVVGFAALSDPALLLSYAAVDGEEAAVSAPLLGNLFSAREVDPRPFRGAGLA
GLTLHEVRPPA
Download sequence
Identical sequences N0CK71
gi|488607978|ref|YP_007929314.1| WP_015606815.1.90088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]