SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488608358|ref|YP_007929694.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488608358|ref|YP_007929694.1|
Domain Number 1 Region: 283-424
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.23e-21
Family N-acetyl transferase, NAT 0.01
Further Details:      
 
Weak hits

Sequence:  gi|488608358|ref|YP_007929694.1|
Domain Number - Region: 104-165
Classification Level Classification E-value
Superfamily ACT-like 0.0016
Family Phenylalanine metabolism regulatory domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488608358|ref|YP_007929694.1|
Sequence length 471
Comment GCN5-related N-acetyltransferase [Streptomyces fulvissimus DSM 40593]
Sequence
MTSSKTARRPHHWRRDLIELAALFTAVAVADAIANLIGHQPDGPYLLMASAVALVATATF
HTWWARRHSNAPPPEEPGRSDPAPDEVTGSIDGSGAGETVLWRMRTTVRDAPGSLAALCL
VLARFRIDILTLQTHPLAEGTVDEFLLRAPASLPAQELTRQISAAGGTATWIERADAHDL
VDTPTRVLSLATRTALDAAELPLALRQLLGRCTIHSLPAVSITGRPTGESAPVEGVLEET
VMRLRDPSGGVISVERPYLPFTPTEFARARALVELDARLGPRVPRSEDILTLPEGNEITV
RRADRSDLAAARAMHDRCSPGTLGLRYHGPVGDADRYLDHLLSPRFGRTLAVQTASGKLV
ALGHLLWDGDETEVALLVEDDWQRRGIGSELLGRLVQLAEEAGCDSVYAVTQSRNTGMVA
AMRALELPLDYQIEEGTLVITARLTRATDERTARPSGRAAEPSAPAERARR
Download sequence
Identical sequences N0CLA4
gi|488608358|ref|YP_007929694.1| WP_015607194.1.90088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]