SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488609272|ref|YP_007930608.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488609272|ref|YP_007930608.1|
Domain Number 1 Region: 10-183
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.48e-29
Family N-acetyl transferase, NAT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488609272|ref|YP_007930608.1|
Sequence length 185
Comment Acetyltransferase [Streptomyces fulvissimus DSM 40593]
Sequence
MSATTTLHSVSVRPALPADEEALGELDRATWSTLHAVMPRPQPPYDPFFDERHRPEDFLV
AEAATEAVTEAGAPDGSGGTRIAGYIRLVPPTPLACNAHVRQIQGLAVAARARGAGVGRT
LLRAACAEARRQGANRITLRVLGHNTPARALYASEGFAVEGVLSGEFFLHGRYVDDVLMG
RSLAP
Download sequence
Identical sequences N0CT16
WP_015608093.1.90088 gi|488609272|ref|YP_007930608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]