SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488609433|ref|YP_007930769.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488609433|ref|YP_007930769.1|
Domain Number 1 Region: 14-156
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.89e-23
Family N-acetyl transferase, NAT 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488609433|ref|YP_007930769.1|
Sequence length 165
Comment Acetyltransferase [Streptomyces fulvissimus DSM 40593]
Sequence
MPHVNWTVTPERFDSPDATALRRDYYDEVASRYWQRPATAAELAEGLADDGADLLLPPTG
QFVVGRHEGRAASCAGLVLTEETVAGSAELTRVYVRPEFRGTGGGGLLLAAIEEEARALG
VRLLRLDTRNDLVEARGLYAKHGYGEVPAFHRRNPYAEVWFAKEL
Download sequence
Identical sequences A0A1C6P953 N0CPL6
gi|488609433|ref|YP_007930769.1| WP_015608253.1.15473 WP_015608253.1.90088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]