SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488610523|ref|YP_007931859.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488610523|ref|YP_007931859.1|
Domain Number 1 Region: 38-163
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.26e-20
Family N-acetyl transferase, NAT 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488610523|ref|YP_007931859.1|
Sequence length 202
Comment N-acetylglutamate synthase [Streptomyces fulvissimus DSM 40593]
Sequence
MTRSRRAGDSVGGMSSEQPQTEPDTDFHTDPSVNKPAITVRRARTTDVSSVRRLLDGYVS
GGILLDKATVTLYEDIQEFWVAERDEDARVIGCGALHVMWEDLAEVRTLAVDPRIKGAGV
GHHVLEKLLQTARWLGVRRVFCLTFEVDFFAKHGFVEIGETPVDTDVYSELLRSYDEGVA
EFLGLERVKPNTLGNSRMLLHL
Download sequence
Identical sequences A0A1C6PLB8 N0CST5
gi|488610523|ref|YP_007931859.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]