SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|488611069|ref|YP_007932405.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488611069|ref|YP_007932405.1|
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.83e-28
Family N-acetyl transferase, NAT 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488611069|ref|YP_007932405.1|
Sequence length 150
Comment GCN5-related N-acetyltransferase [Streptomyces fulvissimus DSM 40593]
Sequence
MSDLEIRPVIETDLDAVVAMLADDPLGAQRESPDDLTPYRAALRRLADDPNQHVVVAVRE
DRVVGTLQLTVVPGLSRQGATRSIIEAVRIHADERGSGLGTQLIQWAVDESRRQDCQLVQ
LTSDVTREDAHRFYERLGFTASHVGFKLAL
Download sequence
Identical sequences N0CSC7
WP_015609872.1.90088 gi|488611069|ref|YP_007932405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]