SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488611810|ref|YP_007933146.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488611810|ref|YP_007933146.1|
Domain Number 1 Region: 26-178
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.61e-30
Family N-acetyl transferase, NAT 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488611810|ref|YP_007933146.1|
Sequence length 194
Comment GCN5-related N-acetyltransferase [Streptomyces fulvissimus DSM 40593]
Sequence
MSRAVYGGLLNNPPKGSLMSIAPVPPTAPAPAVRLRVPTDEDALFWHRVFDDPEVMEFFG
GRRADFSVYEELTARQRRHDAELGYCLWTVTDEDGTVLGFTGAQPWPHTHYGPVGAIEIG
WRLGRSAWGHGYATAAARTTLERLRAAGVPDVVAMIDSRNARSIAVAERLGMRLAETFTT
PRPGQEARCYRLEL
Download sequence
Identical sequences A0A1C6MV91 N0CSV7
gi|488611810|ref|YP_007933146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]