SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488612801|ref|YP_007934137.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488612801|ref|YP_007934137.1|
Domain Number 1 Region: 8-175
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.64e-39
Family N-acetyl transferase, NAT 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488612801|ref|YP_007934137.1|
Sequence length 185
Comment Acetyltransferase [Streptomyces fulvissimus DSM 40593]
Sequence
MFAISLGDDKAELRPLEVWQAEEFLTHMDRARELVDPWIPFASFATDLDSARALLQRYAE
KQAADTGRLYGIWLEGTLVGGVLFRIFDAASGNCEIGVWLEPAAQGRGLITRAAERLIDW
AVFERGMHRIEWDASAANTRSIAVAQRLGMTRDGVLRQNYLYRGERHDSEIWSVLAPEWR
ARTGR
Download sequence
Identical sequences A0A1C6LIQ5 N0D4P2
WP_015611564.1.90088 gi|488612801|ref|YP_007934137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]