SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488613849|ref|YP_007935185.1| from Streptomyces fulvissimus DSM 40593

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488613849|ref|YP_007935185.1|
Domain Number 1 Region: 122-234
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000174
Family N-acetyl transferase, NAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488613849|ref|YP_007935185.1|
Sequence length 242
Comment GCN5-related N-acetyltransferase [Streptomyces fulvissimus DSM 40593]
Sequence
MSIDSPAGRARALWQEQAAAPDAVFGTPGRPAVLVSPASSLAPPSWVGVVTIGDTALITA
PTTRAADSVTTALAGLPTDRLTDPATVTGLLPVADTLGPAVLAYLAPNALRPPRATGTPT
GRLTPGHAALWALSEEAGEEDAGESGLEEITSPVFVVRDGGAGVLAAAGYAHWPRDTAHL
CVLTAPGARGRGFARQVASEATAHALAAGLLPQWRARPAASRRVAAALGYRELGAQLSVR
LV
Download sequence
Identical sequences N0CZT4
WP_015612594.1.90088 gi|488613849|ref|YP_007935185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]