SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000001008 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000001008
Domain Number 1 Region: 258-414
Classification Level Classification E-value
Superfamily TPR-like 6.33e-34
Family Tetratricopeptide repeat (TPR) 0.000000113
Further Details:      
 
Domain Number 2 Region: 142-257
Classification Level Classification E-value
Superfamily FKBP-like 9.43e-28
Family FKBP immunophilin/proline isomerase 0.00000103
Further Details:      
 
Domain Number 3 Region: 68-132
Classification Level Classification E-value
Superfamily FKBP-like 1.96e-19
Family FKBP immunophilin/proline isomerase 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000001008
Sequence length 459
Comment FKBP4 (Homo_sapiens) FK506 binding protein 4, 59kDa
Sequence
MPSRSTQGTWCLTPLSSIEKETQAIIRAPPAAAEGLEIKSVLMVLAKSPGTEGPCLASPS
GSNTSGLEVIKREGKGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVI
KAWDIAVATMKVELFEFKGEDLTEDEDGGIIRRIQTRGEGYSRPNDGAIVEVTLEGYYKD
QLFDQREVRFEVGDGESQDLPCGLEKAIQRMEKGEHSIVYLKPSYGFGSVGKEKFQIPPN
AELRYEIHLKNFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWL
EYESSFSDEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDNNNEKGLFRRG
EAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRIRKQLAREKKLYANMFERLAE
KENKAKAEAATGDHHTDTEMKAELKKDASGTQPQVETEA
Download sequence
Identical sequences G5AS19
HGL_H00000001008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]