SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000005198-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000005198-1
Domain Number 1 Region: 94-371
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-77
Family Protein kinases, catalytic subunit 0.000017
Further Details:      
 
Domain Number 2 Region: 15-67
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000748
Family SH3-domain 0.0017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000005198-1
Domain Number - Region: 390-458
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00259
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000005198-1
Sequence length 1086
Comment MAP3K9 (Homo_sapiens) mitogen-activated protein kinase kinase kinase 9
Sequence
XEEEEEAAAASGELGCTAQLPYWTAVFEYEAAGEDELTLRLGDVVEVLSKDSQVSGDEGW
WTGQLNQRLWTSPRLTRLSPHSVAEGQPSWSPVHCLSLLPGCQMLEIDFVELTLEEIIGI
GGFGKVYRAFWIGDEVAVKAARYDPDEDISQTIENVRQEAKLFAMLKHPNIIALRGVCLK
EPNLCLVMEFARGGPLNRVLSGKRIPPDILVNWAVQIARGMNYLHDEAIVPIIHRDLKSS
NILILQKVENGDLSNKILKITDFGLAREWHRTTKMSAAGTYAWMAPEVIRSSMFSKGSDV
WSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPEPFAKLMEDCWNPDPHL
RPSFTSILDQLTTIEESGFFEMPKDSFHCLQDDWKHEIQEMFDQLRAKEKELRTWEEELT
RAALQQKNQEELLRRREQELAEREIDILERELNIIIHQLCQEKPRVKKRKGKFRKSRLKL
KDGNRISLPSDFQHKFTVQASPTMDKRKSLINSHSSPPASPTIIPRLRAIQLTPGESSKT
WGRSSVIPKEEEEEEKRVPKKKGRTWGPGTLGQKELTSGDEGSPQRREKANGLNTPSESP
HFHLGLKSLVDGYRQWSSSAPNLGKGPRSSPALPGFTSLMEMGLVSVSHFSYTLVFTEDE
DSEGPRGGENRLQPSPSQSYLCTPFPRGEDGDGPPSDGVHEEPTPVNSATSTPQLTPTNS
LKRSGTHHRRCEMALLGCGAVLAATGLGFDLLEAGRCQLLPAEEPEAPVREEKKKREGLF
QRASRPRRSTSPPSRKLFKREEPVLLLGDPSASLTLLSLSSISECNSTRSLLRSDSDEIV
VYEMPVSPVQAPPRTPCTHNPLVNVRVERFKRDPNQSLTPTHVTLTAPAQLSGHRRTPSD
GALTPAALLASRSPSSNGLSPSRGSGMLKTPSPSRDPGEFPRLPDPNMVFPPTPRRWHTQ
QDSALERPKTLEFLPRPRPSANRQRLDPWWFVSPSRARSASPANSSSTETPSNLDSCFAS
SSSTVEERPGLPALLSFQAGPLPPAERTLLDLDAEGQSQDSTVPLCRAELNTHRPTPYEI
QQEFWS
Download sequence
Identical sequences HGL_H00000005198-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]