SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000005260 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000005260
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.36e-81
Family IMD domain 0.000000643
Further Details:      
 
Domain Number 2 Region: 319-384
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000021
Family SH3-domain 0.0000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000005260
Sequence length 492
Comment BAIAP2L1 (Homo_sapiens) BAI1-associated protein 2-like 1
Sequence
MEQFNPGLRNLINLGKNYEKAVNAMIMAGKAYYDGVAKVGEMASGSPVSTELGHVLIEIS
STHKKLNETLDENFRKFHKEIIHELEKKTELDVKYMHATLKRYQAEHRSKLDSLEKSQAE
LKKIRRKSQGGRNALKYEHKEIEYVETVTSRQSEIQKFIADGCKEALLEEKRRFCFLVDK
HCGFANHIHRYHLQSAELLNSKLPRWQETCCDATKVPQKVMSMIEEIRTPVSTPVSGTPQ
PSPMTERSSAVRKDNDTLSEYSPKIPPALPSAKEYTSPLIDMFNNPATVTENSEKTNNSK
DTSEDASLQRSVSVSTGLNMMKKQKVKTIFPHTAGTNKTLLSFAQGDLITLLIPEEKDGW
LYGEHDATKARGWFPSSYTKLLEENAKEPVSIPTPSPAPVRSISTVDLSEKSNVIIPPPD
YLACLSTGTAADKQADVAKNTSTFRASASRPEAVSSSDANGIAKPPFLSGENPFATVKLR
PTVTNDRSAPII
Download sequence
Identical sequences G5AX80
HGL_H00000005260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]